LL-37 5mg (CAP-18)

Name: LL-37 5mg (CAP-18)
Brand: Buy Peptides
SKU: ll-37
Price: 79.99 USD
Availability: InStock

$79.99

Buy LL-37 for sale which is available in lyophilized powder peptide form, in 5mg vials.

In stock

Full description

SKU: ll-37 Category: Buy Peptides Tag: peptides

Description
Additional information

Description

About LL-37: LL-37 is a cationic and α-helical antimicrobial peptide expressed in human bone marrow, testis, granulocytes, and gingival epithelium and is upregulated in psoriatic lesions.¹ It inhibits growth of Gram-positive E. coli D21 and Gram-negative B. megatarium in a concentration-dependent manner and LL-37 expression is induced in A549 epithelial cells, alveolar macrophages, neutrophils, and monocyte-derived macrophages following M. tuberculosis infection.^1,2,3 LL-37 binds sheep erythrocytes coated with S. minnesota Re-LPS and induces agglutination with a minimal agglutinating concentration (MAC) of 12.1 μg/ml.⁴

It is a chemoattractant for, and can induce calcium mobilization in, human monocytes, neutrophils, and T cells that naturally express formyl peptide receptor-like 1 (FPRL1) and FPRL1-transfected HEK293 cells.⁵ LL-37 (10-15 μM) pretreatment of dengue virus type 2 (DENV-2) reduces its infectivity as well as levels of viral genomic RNA and NS1 antigen.⁶In vivo, LL-37 inhibits cecal ligation and puncture-induced caspase-1 activation and pyroptosis of peritoneal macrophages, reduces levels of the inflammatory cytokines IL-1β, IL-6, and TNF-α, and improves survival in polybacterial septic mice.⁷

Buy LL-37 cathelicidin antimicrobial peptide online today from GenX Peptides.

We offer the highest grade and purity of LL-37 for sale at a competitive price in the USA. For best results buy LL-37 peptides of the highest quality from GenX Peptides.

For more information on LL-37 peptide please visit Pubmed.

References & Product Citations

Product Description References

1. Weinberg, A., Krisanaprakornkit, S., and Dale, B.A. Epithelial antimicrobial peptides: Review and significance for oral applications. Crit. Rev. Oral Biol. Med. 9(4), 399-414 (1998).

2. Rivas-Santiago, B., Hernandez-Pando, R., Carranza, C., et al. Expression of cathelicidin LL-37 during Mycobacterium tuberculosis infection in human alveolar macrophages, monocytes, neutrophils, and epithelial cells. Infect. Immun. 76(3), 935-941 (2008).

3. Gudmundsson, G.H., Agerberth, B., Odeberg, J., et al. The human gene FALL39 and processing of the cathelin precursor to the antibacterial peptide LL-37 in granulocytes. Eur. J. Biochem. 238(2), 325-332 (1996).

4. Larrick, J.W., Hirata, M., Balint, R.F., et al. Human CAP18: A novel antimicrobial lipopolysaccharide-binding protein. Infect. Immun. 63(4), 1291-1297 (1995).

5. Yang, B.D., Chen, Q., Schmidt, A.P., et al. LL-37, the neutrophil granule- and epithelial cell-derived cathelicidin, utilizes formyl peptide receptor-like 1 (FPRL1) as a receptor to chemoattract human peripheral blood neutrophils, monocytes, and T cells. J. Exp. Med. 192(7), 1069-1074 (2000).

6. Alagarasu, K., Patil, P.S., Shil, P., et al. In-vitro effect of human cathelicidin antimicrobial peptide LL-37 on dengue virus type 2. Peptides 92, 23-30 (2017).

7. Hu, Z., Murakami, T., Suzuki, K., et al. Antimicrobial cathelicidin peptide LL-37 inhibits the pyroptosis of macrophages and improves the survival of polybacterial septic mice. Int. Immunol. 28(5), 245-253 (2016).

Unit Size	5 mg/vial
Unit Quantity	1 Vial
Molecular Formula	C₂₀₅H₃₄₀N₆₀O₅₃
Molecular Weight	4493.3
Sequence Shortening	LLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES
Appearance	White Powder
Peptide Purity	>99%
Solubility	Insoluble in water. Dissolve the peptide in 10% acetonitrile with 0.1% TFA solution. Further dilute with desired buffer.
Source	Chemical Synthesis
Storage	Lyophilized LL-37 is stable at room temperature for 90 days. However, it should be stored in a freezer below -8C for any extended period.
Safety Information	For Research Only. Not Intended for Diagnostic or Therapeutic Use.